PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.006G182000.1
Common NamePHAVU_006G182000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family HB-other
Protein Properties Length: 1754aa    MW: 198208 Da    PI: 5.4719
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.006G182000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.31.3e-184196257
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                         kR+  t+ qle+Le++++ ++yps+ +r+eL++klgL++rq ++WF+ rR k+kk
  Phvul.006G182000.1 41 PKRQMKTPFQLETLEKAYAVENYPSEMMRAELSEKLGLSDRQLQMWFCHRRLKDKK 96
                        69****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-181997IPR009057Homeodomain-like
SuperFamilySSF466893.81E-172796IPR009057Homeodomain-like
PROSITE profilePS5007116.8443797IPR001356Homeobox domain
SMARTSM003891.0E-1839101IPR001356Homeobox domain
PfamPF000462.7E-164196IPR001356Homeobox domain
CDDcd000862.04E-144297No hitNo description
PROSITE profilePS5082717.048549608IPR018501DDT domain
SMARTSM005718.5E-23549608IPR018501DDT domain
PfamPF027912.1E-17551605IPR018501DDT domain
PfamPF050662.6E-16731799IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156122.3E-7940983IPR028942WHIM1 domain
PfamPF156131.9E-1311201192IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1754 aa     Download sequence    Send to blast
MEAEAEAENN EVKREENSND NNNNNESNSK FGNSSEGQSK PKRQMKTPFQ LETLEKAYAV  60
ENYPSEMMRA ELSEKLGLSD RQLQMWFCHR RLKDKKELPS KKPRKAAALP DSPVEEPKLA  120
SEVGPEYGSG SGSGSSPFTR SELRNVVPRG YYESPQTIME LRAIACVEAQ LGEPLREDGP  180
ILGVEFDPLP PDAFGAPLAV TDPQKRPSLA YENKMYERHD VRTNKAITRT FHEYPFLPSQ  240
SGIRSDVFGQ INLPHLHEPM EGPARTPFPL GNEQQPRIHA PQSHSSRVRV LSQPQDKQVI  300
PYPSPPQEND IVPKREPHIN TTNTVMNSHY TTDHPIVGQE IPYALPGGQV SHNDAVLRME  360
RKRKIDEARV AKEVEAYEMR MRKELEKQDN LKRKSEERMK KEMERQDRER RKEEERLLRE  420
KQREEERLKR EQRRELERRE KFLLREHLRA EKRRQKEEIR KEKEEERRKA ALEKANARRI  480
AKESMELIED EQLELMELAA ASKGLSSIIH IDLDTLQNLE SFRDSLCVFP PKSVKLRKPF  540
AIQPWSNSEQ NVGNLLMVWR FLITFADVLD LWPFTLDEFV QAFHDYDSRL LGEIHVALLK  600
VIIKDIEDVA RTPSTGLGMN QNGAANPGGG HPEIVEGAYA WGFDIRNWQK NLNQLTWPEI  660
FRQLALSAGL GPHLKKRSIA WSYTIDKDEG KSGVDIISTL RNGSAAESAV AKMQERGLLA  720
PRRSRHRLTP GTVKFAAFHV LSLEGSKGLT VLELAEKIQK SGLRDLTTSK TPEASISVAL  780
TRDTKLFERI APSTYCVRDA FRKDPADADS ILTEARKKIQ IFENGFLAGE DADDVEREEE  840
SESDEVDEDP EDEDLVNPSS ANQNSEQYED TNICSSNGKE NLDHNIDLLR NEFDTDLPCF  900
PKNGSTDADC PSSVTRSVTR GDLNAGNIDQ DNMEIDESIS GESWILGLAE GEYSVLSVEE  960
RLKALVALVG VANEGNSIRV VLEDRLESAN ALKKQMWADA QIDKVRLKDD NIGKLDFPSL  1020
TGNKVETQYT YPTVEGNQSP IMLDININNN EASPSTAENR KGDPVALSMP MEKSSSVQDF  1080
CTGTGADIPQ TQVPAQYSKR SRSQLKSYFA HLAEEMYVYR SLPLGQDRRR NRYWQFVASA  1140
SSNDPGSGRI FVECHDGKWW LIDSEEAFDS LLTSLDSRGL RESHLRLMLQ KIENSFKENI  1200
RKRNAHCTKN GSKGEVSIKI EANEPYSIPD HNAGSDSPSS TLHDLNTDTS ETSSSFKIEL  1260
GKSESEKKAA LRRYQDFQKW LWKECYNSSV LCAMKHGVKR CKPQMDICDT CLDLCFVEDS  1320
HCSSCHRTFP SNNGFNFSKH AFQCRDKLSK DNYTLEYSLP LRTRLLKVLL ACMEVSVLSE  1380
AFGTNWTDDI RRHWGVKLSK SSSVEELIQI LTLFEKALRR DFLSSNFSTT DELLGSSSMP  1440
ECSGQPSTDP ESVAVLPWVP LTTAALSLRL FEIDSSISYV KPERLEPSEE KEAREYIRFP  1500
SRYTHLKSNR EVEPAEFDHD EFTKDKSVPK KIVRNGNKRS RGTNEPGRGK KLAKRVYNSK  1560
RDGGRKNAKV TVNLSHKLKQ QARGTQGQGA GRGRRTLRKR RVGKRAVEDL LLGHTTASHS  1620
SKIDREPLKN LDEEWDREKA SPMTPVHIGV AADVSNSAEE VESDYDHTQA VEYDQGNWEV  1680
GFNGVPPNRW SRDLVGMSDE DVDASEDDND NGIEENEEED SEADVMSEGS DGMGNRVVNV  1740
GGSYSALSED SSD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18996RRLKDKKE
2427433LKREQRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150380.0AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007148118.10.0hypothetical protein PHAVU_006G182000g
SwissprotF4HY560.0RLT1_ARATH; Homeobox-DDT domain protein RLT1
TrEMBLV7BQ440.0V7BQ44_PHAVU; Uncharacterized protein
STRINGGLYMA13G30860.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25233369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28420.10.0homeobox-1